Quick note. When I was comparing the protein sequences from C. glomerans PW2 to those in E. coli K12 MG1655, the program would get stuck with this sequence: >gi|328954742|ref|YP_004372075.1| MSKTIPELTLDNFDLVMQSKLPVLVDFWAPWCGPCRTLSPIVEQVAEEMSERITVAKCNVDENQDLAMKYGVMS IPTLVLFRDGAEVSRTVGAMPKPKLVAEIEKNL I could not figure out the problem, but found that compiling with gcc-4 installed by fink fixed the problem. I just had to change this … Continue reading If ssearch36 gets stuck while comparing sequences in your mac
EMBOSS compiled under Mountain Lion
Yes, compiling again. This story is a little different. I was kind of surprised that EMBOSS latest version continued to be 6.4.0 as per their web page. For some reason, I went to the ftp site anyway, instead of clicking at the direct link to the "latest" version. Guess what I found? You've got it, … Continue reading EMBOSS compiled under Mountain Lion
I compiled NCBI’s BLAST 2.2.27+ under Mountain Lion
What? This has been no problem to you? If so, let me know, because it was giving me an error 11 thing (look further down), that was just impossible to understand. People around the web were saying that this error meant that the RAM was shitty, but this error happened in every mac I have. … Continue reading I compiled NCBI’s BLAST 2.2.27+ under Mountain Lion