Quick note. When I was comparing the protein sequences from C. glomerans PW2 to those in E. coli K12 MG1655, the program would get stuck with this sequence: >gi|328954742|ref|YP_004372075.1| MSKTIPELTLDNFDLVMQSKLPVLVDFWAPWCGPCRTLSPIVEQVAEEMSERITVAKCNVDENQDLAMKYGVMS IPTLVLFRDGAEVSRTVGAMPKPKLVAEIEKNL I could not figure out the problem, but found that compiling with gcc-4 installed by fink fixed the problem. I just had to change this … Continue reading If ssearch36 gets stuck while comparing sequences in your mac